SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jxv_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jxv_C
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 2.35e-102
Family Nucleoside diphosphate kinase, NDK 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1jxv_C
Sequence length 152
Comment mol:protein length:152 Nucleoside Diphosphate Kinase A
Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Download sequence
Identical sequences P15531 Q5RC56
000141313|e3l7uA1|304.34.1.1|A:21-172 000404871|e3l7uC1|304.34.1.1|C:21-172 cath|current|1jxvA00/4-152 cath|current|1jxvB00/4-152 cath|current|1jxvC00/4-152 cath|current|1jxvD00/4-152 cath|current|1jxvE00/4-152 cath|current|1jxvF00/4-152 d3l7ua_ d3l7ub1 d3l7uc_ gi|4557797|ref|NP_000260.1| ENSP00000376892 ENSGGOP00000025664 1jxvA ENSP00000376892 NP_000260.1.87134 NP_000260.1.92137 XP_004090366.1.23891 XP_008968877.1.60992 XP_014197656.1.60992 XP_018883396.1.27298 1jxv_A 1jxv_B 1jxv_C 1jxv_D 1jxv_E 1jxv_F 2hvd_A 2hvd_B 2hvd_C 4eno_A 4eno_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]