SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k6w_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k6w_A
Domain Number 1 Region: 56-375
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.91e-108
Family Cytosine deaminase catalytic domain 0.000000000012
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0000000000000396
Family Cytosine deaminase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1k6w_A
Sequence length 426
Comment mol:protein length:426 Cytosine Deaminase
Sequence
snnalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvep
hihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvr
thvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvv
gaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmga
rvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvke
mlesginvcfghddvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsart
lnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpe
aidykr
Download sequence
Identical sequences 1k6w_A 1k70_A 1k6wA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]