SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kg5_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kg5_A
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.41e-79
Family Mismatch glycosylase 0.00000000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1kg5_A
Sequence length 225
Comment mol:protein length:225 A/G-specific adenine glycosylase
Sequence
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvqrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
Download sequence
Identical sequences 1kg5_A 1kg5A d1kg5a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]