SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kvj_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kvj_A
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.76e-32
Family HMA, heavy metal-associated domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1kvj_A
Sequence length 79
Comment mol:protein length:79 Copper-transporting ATPase 1
Sequence
mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
tlqeaiddmgfdavihnpd
Download sequence
Identical sequences 1kvi_A 1kvj_A 1kvjA cath|current|1kviA00/1-79 cath|current|1kvjA00/1-79 d1kvia_ d1kvja_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]