SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mh3_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mh3_A
Domain Number 1 Region: 6-367
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.49e-128
Family Phosphate binding protein-like 0.000000000275
Further Details:      
 
Domain Number 2 Region: 371-421
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000118
Family Homeodomain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1mh3_A
Sequence length 421
Comment mol:protein length:421 maltose binding-a1 homeodomain protein chimera
Sequence
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtaaaaaispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
k
Download sequence
Identical sequences 1mh3A 1mh3_A 1mh4_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]