SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mnm_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mnm_D
Domain Number 1 Region: 16-86
Classification Level Classification E-value
Superfamily Homeodomain-like 2.17e-17
Family Homeodomain 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1mnm_D
Sequence length 87
Comment mol:protein length:87 PROTEIN (MAT ALPHA-2 TRANSCRIPTIONAL REPRESSOR)
Sequence
qltqknksadglvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkgl
enlmkntslsriqiknwvsnrrrkekt
Download sequence
Identical sequences cath|current|1mnmC00/113-189 cath|current|1mnmD00/113-189 1mnmC 1mnm_C 1mnm_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]