SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1n5o_X from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1n5o_X
Domain Number 1 Region: 5-111
Classification Level Classification E-value
Superfamily BRCT domain 3.95e-28
Family BRCT domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 114-212
Classification Level Classification E-value
Superfamily BRCT domain 1.01e-24
Family BRCT domain 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1n5o_X
Sequence length 214
Comment mol:protein length:214 Breast cancer type 1 susceptibility protein
Sequence
vnkrmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyfl
giaggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqdrkifrgle
iccygpftnrptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedngfhaig
qmceapvvtrewvldsvalyqcqeldtylipqip
Download sequence
Identical sequences 1n5oX 1n5o_X

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]