SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1o96_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o96_B
Domain Number 1 Region: 197-317
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.49e-40
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.000000606
Further Details:      
 
Domain Number 2 Region: 2-189
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.49e-38
Family ETFP subunits 0.0000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1o96_B
Sequence length 320
Comment mol:protein length:320 ELECTRON TRANSFERRING FLAVOPROTEIN ALPHA-SUBUNIT
Sequence
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvevgggndidittvdfimsigrgigeetnveqfreladeagatlccsrpiad
agwlpksrqvgqsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiak
ygivadifdieeelkaqlaa
Download sequence
Identical sequences 1o97D 1o94_D 1o94_F 1o95_D 1o95_F 1o96_B 1o96_D 1o96_F 1o96_Z 1o97_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]