SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ols_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ols_A
Domain Number 1 Region: 28-395
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.82e-118
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1ols_A
Sequence length 400
Comment mol:protein length:400 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
Sequence
sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
Download sequence
Identical sequences cath|current|1dtwA00/7-400 cath|current|1olsA00/6-400 cath|current|1olxA00/5-400 cath|current|1u5bA00/6-400 cath|current|1wciA00/6-400 cath|current|2beuA00/6-400 cath|current|2bevA00/6-400 cath|current|2bewA00/6-400 2bevA 1dtw_A 1ols_A 1olx_A 1u5b_A 1wci_A 1x80_A 2beu_A 2bev_A 2bew_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]