SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1olu_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1olu_A
Domain Number 1 Region: 28-395
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.39e-117
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1olu_A
Sequence length 400
Comment mol:protein length:400 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
Sequence
sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighastsddssay
rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
Download sequence
Identical sequences 1v1rA cath|current|1oluA00/7-400 cath|current|1v1rA00/14-400 1olu_A 1v1r_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]