SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ooh_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ooh_A
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 9.52e-33
Family Insect pheromone/odorant-binding proteins 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1ooh_A
Sequence length 126
Comment mol:protein length:126 odorant binding protein LUSH
Sequence
shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
gqfmwp
Download sequence
Identical sequences 000003204|e1oohA1|108.2.1.1|A:1-126 000049473|e1oohB1|108.2.1.1|B:1-126 cath|current|1oohA00/-1-124 cath|current|1oohB00/-1-124 1ooh_A 1ooh_B 1oohA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]