SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1oqa_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1oqa_A
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily BRCT domain 7.32e-26
Family BRCT domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1oqa_A
Sequence length 110
Comment mol:protein length:110 Breast cancer type 1 susceptibility protein
Sequence
gsqdrkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpd
awtedngfhaigqmceapvvtrewvldsvalyqcqeldtylipqiphshy
Download sequence
Identical sequences 1oqa_A 1oqaA cath|current|1oqaA00/1-110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]