SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ovm_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ovm_C
Domain Number 1 Region: 360-532
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.28e-55
Family Pyruvate oxidase and decarboxylase PP module 0.000000265
Further Details:      
 
Domain Number 2 Region: 7-121
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.74e-43
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000237
Further Details:      
 
Domain Number 3 Region: 167-337
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.34e-31
Family Pyruvate oxidase and decarboxylase, middle domain 0.000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1ovm_C
Sequence length 552
Comment mol:protein length:552 Indole-3-pyruvate decarboxylase
Sequence
MRTPYCVADYLLDRLTDCGADHLFGVPGDYNLQFLDHVIDSPDICWVGCANELNASYAAD
GYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQRGELLHHTLGD
GEFRHFYHMSEPITVAQAVLTEQNACYEIDRVLTTMLRERRPGYLMLPADVAKKAATPPV
NALTHKQAHADSACLKAFRDAAENKLAMSKRTALLADFLVLRHGLKHALQKWVKEVPMAH
ATMLMGKGIFDERQAGFYGTYSGSASTGAVKEAIEGADTVLCVGTRFTDTLTAGFTHQLT
PAQTIEVQPHAARVGDVWFTGIPMNQAIETLVELCKQHVHAGLMSSSSGAIPFPQPDGSL
TQENFWRTLQTFIRPGDIILADQGTSAFGAIDLRLPADVNFIVQPLWGSIGYTLAAAFGA
QTACPNRRVIVLTGDGAAQLTIQELGSMLRDKQHPIILVLNNEGYTVERAIHGAEQRYND
IALWNWTHIPQALSLDPQSECWRVSEAEQLADVLEKVAHHERLSLIEVMLPKADIPPLLG
ALTKALEACNNA
Download sequence
Identical sequences P23234
1ovmA WP_073396207.1.89102 1ovm_A 1ovm_B 1ovm_C 1ovm_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]