SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1p6t_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p6t_A
Domain Number 1 Region: 11-71
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.39e-33
Family HMA, heavy metal-associated domain 0.00063
Further Details:      
 
Domain Number 2 Region: 75-137
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.03e-30
Family HMA, heavy metal-associated domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1p6t_A
Sequence length 151
Comment mol:protein length:151 Potential copper-transporting ATPase
Sequence
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvvtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynp
keasvsdlkeavdklgyklklkgeqdsiegr
Download sequence
Identical sequences 1p6t_A 1p6tA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]