SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pu6_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pu6_B
Domain Number 1 Region: 5-211
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.51e-46
Family 3-Methyladenine DNA glycosylase III (MagIII) 0.00000000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1pu6_B
Sequence length 218
Comment mol:protein length:218 3-METHYLADENINE DNA GLYCOSYLASE
Sequence
vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
nlnsalalyentislaqlyarfhgkivefskqklelkl
Download sequence
Identical sequences 1pu6A 1pu6_A 1pu6_B 1pu7_A 1pu7_B 1pu8_A 1pu8_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]