SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1q17_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q17_A
Domain Number 1 Region: 32-292
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.14e-96
Family Sir2 family of transcriptional regulators 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1q17_A
Sequence length 300
Comment mol:protein length:300 HST2 protein
Sequence
hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
elvkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfasl
peeiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
Download sequence
Identical sequences 1q17A 1q17_A 1q17_B 1q17_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]