SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qgd_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qgd_B
Domain Number 1 Region: 4-327
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.16e-245
Family TK-like PP module 0.00000224
Further Details:      
 
Domain Number 2 Region: 333-522
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-117
Family TK-like Pyr module 0.0000165
Further Details:      
 
Domain Number 3 Region: 535-662
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.98e-75
Family Transketolase C-terminal domain-like 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1qgd_B
Sequence length 662
Comment mol:protein length:662 PROTEIN (TRANSKETOLASE)
Sequence
ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgktagvetttgplgqgia
navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
ll
Download sequence
Identical sequences 1qgd_A 1qgd_B 1qgdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]