SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1r9j_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1r9j_A
Domain Number 1 Region: 7-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.71e-193
Family TK-like PP module 0.0000000544
Further Details:      
 
Domain Number 2 Region: 337-523
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.13e-102
Family TK-like Pyr module 0.00000646
Further Details:      
 
Domain Number 3 Region: 530-648
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.98e-47
Family Transketolase C-terminal domain-like 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1r9j_A
Sequence length 673
Comment mol:protein length:673 transketolase
Sequence
rhmasiekvancirclaadivqggksghpgtpmgmapmsavlwtevmkynsqdpdwvdrd
rfvmsnghgcalqyallhmagynltmddlkgfrqdgsrtpghperfvtpgvevttgplgq
gianavglaiaeahlaatfnrpgynivdhytyvycgdgclmegvcqealslaghlalekl
iviydsnyisidgstslsfteqchqkyvamgfhvievkngdtdyeglrkalaeakatkgk
pkmivqtttigfgsskqgtekvhgaplgeedianikakfgrdpqkkydvdddvravfrmh
idkcsaeqkaweellakytaafpaegaafvaqmrgelpsgweaklptnssaiatrkasen
clavlfpaipalmggsadltpsnltrpasanlvdfsssskegryirfgvrehamcailng
ldahdgiipfggtflnfigyalgavrlaaishhrviyvathdsigvgedgpthqpvelva
alrampnlqvirpsdqtetsgawavalssihtptvlclsrqntepqsgssiegvrhgays
vvdvpdlqlvivasgsevslavdaakalsgelrvrvvsmpcqelfdaqpdtyrqavlpag
vpvvsveayvsfgwekyshahvgmsgfgasapagvlykkfgitveevvrtgrelakrfpd
gtaplknssfskm
Download sequence
Identical sequences 1r9j_A 1r9j_B 1r9jA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]