SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rk3_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rk3_A
Domain Number 1 Region: 9-256
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.53e-88
Family Nuclear receptor ligand-binding domain 0.0000000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1rk3_A
Sequence length 292
Comment mol:protein length:292 Vitamin D3 receptor
Sequence
lkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsm
lphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmsw
dcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgv
qdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsf
qpensmkltplvlevfgneislvprgsmaisdpnsssvdklaaalehhhhhh
Download sequence
Identical sequences 1rjk_A 1rk3_A 1rkg_A 1rkh_A 2o4j_A 2o4r_A 2o4jA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]