SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rqd_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rqd_A
Domain Number 1 Region: 13-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.55e-144
Family Deoxyhypusine synthase, DHS 0.00000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1rqd_A
Sequence length 369
Comment mol:protein length:369 Deoxyhypusine synthase
Sequence
MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFG
RAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLV
QHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFE
DWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGS
LGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGA
DYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKMD
AFMHEKNED
Download sequence
Identical sequences A0A024R7D0 P49366
ENSP00000210060 NP_001921.1.87134 NP_001921.1.92137 XP_011526072.1.92137 ENSP00000210060 1rozA gi|4503325|ref|NP_001921.1| cath|current|1rlzA00/9-369 9606.ENSP00000210060 ENSP00000210060 1rlz_A 1roz_A 1roz_B 1rqd_A 1rqd_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]