SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tkb_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tkb_B
Domain Number 1 Region: 9-331
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.25e-214
Family TK-like PP module 0.00000126
Further Details:      
 
Domain Number 2 Region: 336-530
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.7e-114
Family TK-like Pyr module 0.00024
Further Details:      
 
Domain Number 3 Region: 542-666
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.46e-52
Family Transketolase C-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1tkb_B
Sequence length 678
Comment mol:protein length:678 TRANSKETOLASE
Sequence
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
tiafykgdklisplkkaf
Download sequence
Identical sequences 1tkbA 1tka_A 1tka_B 1tkb_A 1tkb_B 1tkc_A 1tkc_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]