SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vh8_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vh8_A
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily IpsF-like 2.34e-116
Family IpsF-like 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1vh8_A
Sequence length 170
Comment mol:protein length:170 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Sequence
mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
Download sequence
Identical sequences 1vh8A 1vh8_A 1vh8_B 1vh8_C 1vh8_D 1vh8_E 1vh8_F 1vha_A 1vha_B 1vha_C 1vha_D 1vha_E 1vha_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]