SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1vih_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vih_A
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.89e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1vih_A
Sequence length 71
Comment mol:protein length:71 VIGILIN
Sequence
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas
Download sequence
Identical sequences 000005923|e1vigA1|327.11.2.1|A:1-71 000070775|e1vihA1|327.11.2.1|A:1-71 cath|current|1vigA00/6-76 cath|current|1vihA00/6-76 d1viga_ d1viha_ 1vig_A 1vih_A 1vigA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]