SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1weg_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1weg_A
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.46e-79
Family Mismatch glycosylase 0.00000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1weg_A
Sequence length 225
Comment mol:protein length:225 A/G-specific adenine glycosylase
Sequence
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvarvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
Download sequence
Identical sequences d1wega_ 1kg4_A 1weg_A 1kg4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]