SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wei_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wei_A
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.46e-79
Family Mismatch glycosylase 0.00000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1wei_A
Sequence length 225
Comment mol:protein length:225 A/G-specific adenine glycosylase
Sequence
mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
Download sequence
Identical sequences 1wef_A 1wei_A 1weiA d1wefa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]