SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wri_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wri_A
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.98e-37
Family 2Fe-2S ferredoxin-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1wri_A
Sequence length 93
Comment mol:protein length:93 Ferredoxin II
Sequence
AYKVTLKTPDGDITFDVEPGERLIDIGSEKADLPLSCQAGACSTCLGKIVSGTVDQSEGS
FLDDEQIEQGYVLTCIAIPESDVVIETHKEDEL
Download sequence
Identical sequences P00237
1wri_A 000006105|e1wriA1|221.1.1.12|A:1-93 cath|current|1wriA00/1-93 d1wria_ 1wriA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]