SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wyz_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wyz_D
Domain Number 1 Region: 4-233
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 6.66e-67
Family Tetrapyrrole methylase 0.000000000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1wyz_D
Sequence length 242
Comment mol:protein length:242 putative S-adenosylmethionine-dependent methyltransferase
Sequence
metalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididslt
fyplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvg
pssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhk
miedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyklehhhh
hh
Download sequence
Identical sequences 1wyzA 1wyz_A 1wyz_B 1wyz_C 1wyz_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]