SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xip_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xip_A
Domain Number 1 Region: 3-382
Classification Level Classification E-value
Superfamily Nucleoporin domain 1.02e-61
Family Nucleoporin domain 0.000000000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1xip_A
Sequence length 388
Comment mol:protein length:388 Nucleoporin NUP159
Sequence
gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdti
erlplvyilnnegslqivglfhvaaiks
Download sequence
Identical sequences 1xip_A 3rrm_C cath|current|3pezC00/0-381 cath|current|3rrmC00/0-381 1xipA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]