SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ynj_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ynj_B
Domain Number 1 Region: 50-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 8.78e-41
Family Insert subdomain of RNA polymerase alpha subunit 0.000000375
Further Details:      
 
Domain Number 2 Region: 11-50,173-227
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.64e-32
Family RNA polymerase alpha subunit dimerisation domain 0.0000181
Further Details:      
 
Domain Number 3 Region: 252-312
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 5.86e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1ynj_B
Sequence length 314
Comment mol:protein length:314 DNA-directed RNA polymerase alpha chain
Sequence
MLESKLKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIED
VLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADV
EIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQ
VEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPTPEVSK
GEKRESAEEDLDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLRNIPGIGERSLEE
IRQALAKKGFTLKE
Download sequence
Identical sequences Q9KWU8
1l9u_A 1l9u_B 1l9u_J 1l9u_K 1l9z_A 1l9z_B 1ynj_A 1ynj_B 1ynn_A 1ynn_B 2gho_A 2gho_B 4xln_A 4xln_B 4xln_G 4xln_H 4xlp_A 4xlp_B 4xlp_G 4xlp_H 4xlq_A 4xlq_B 4xlq_G 4xlq_H 4xlr_A 4xlr_B 4xlr_G 4xlr_H 4xls_A 4xls_B 4xls_G 4xls_H 1l9uA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]