SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ysx_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ysx_A
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Serum albumin-like 3.12e-75
Family Serum albumin-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1ysx_A
Sequence length 201
Comment mol:protein length:201 Serum albumin
Sequence
qnlikqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeak
rmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefna
etftfhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddk
etcfaeegkklvaasqaalgl
Download sequence
Identical sequences 1ysx_A 1ysxA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]