SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zk8_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zk8_B
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.84e-26
Family Tetracyclin repressor-like, C-terminal domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000227
Family Tetracyclin repressor-like, N-terminal domain 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1zk8_B
Sequence length 183
Comment mol:protein length:183 Transcriptional regulator, TetR family
Sequence
MMSPRIGLTLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLG
IYGIKKLHNRLEEAAEDKRMDEAIHALGEAYVAFVRKHPGLYEATFLRDEEVRKAGDGIV
KLCLQVLQQYGLEGENALHATRGFRSICHGFASIEQQGGFGLPLDLDISLHVLLETFIKG
LRE
Download sequence
Identical sequences Q815X4
226900.BC5000 1zk8A NP_834671.1.86172 gi|30023040|ref|NP_834671.1| APC26195 1zk8_A 1zk8_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]