SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2a0b_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2a0b_A
Domain Number 1 Region: 8-120
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.34e-29
Family Aerobic respiration control sensor protein, ArcB 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2a0b_A
Sequence length 125
Comment mol:protein length:125 HPT DOMAIN
Sequence
tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
katkk
Download sequence
Identical sequences cath|current|1a0bA00/658-774 cath|current|1bdjB00/658-774 cath|current|1fr0A00/654-778 cath|current|2a0bA00/657-774 d1fr0a_ 2a0bA 1a0b_A 1bdj_B 1fr0_A 2a0b_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]