SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2art_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2art_A
Domain Number 1 Region: 9-255
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.59e-70
Family LplA-like 0.00000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2art_A
Sequence length 262
Comment mol:protein length:262 Lipoate-protein ligase A
Sequence
MEGRLLLLETPGNTRMSLAYDEAIYRSFQYGDKPILRFYRHDRSVIIGYFQVAEEEVDLD
YMKKNGIMLARRYTGGGAVYHDLGDLNFSVVRSSDDMDITSMFRTMNEAVVNSLRILGLD
ARPGELNDVSIPVNKKTDIMAGEKKIMGAAGAMRKGAKLWHAAMLVHTDLDMLSAVLKVP
DEKFRDKIAKSTRERVANVTDFVDVSIDEVRNALIRGFSETLHIDFREDTITEKEESLAR
ELFDKKYSTEEWNMGLLRKEVV
Download sequence
Identical sequences Q9HKT1
WP_010900939.1.49201 2c8mA APC6457 TaT71 cath|current|2artA00/1-257 cath|current|2aruA00/1-257 cath|current|2c7iA00/1-258 cath|current|2c7iB00/1-256 cath|current|2c7iC00/1-256 cath|current|2c7iD00/1-257 cath|current|2c8mA00/1-256 cath|current|2c8mB00/1-257 cath|current|2c8mC00/1-257 cath|current|2c8mD00/1-255 d3r07a1 gi|16081626|ref|NP_393990.1| 273075.Ta0514 2ars_A 2art_A 2aru_A 2c7i_A 2c7i_B 2c7i_C 2c7i_D 2c8m_A 2c8m_B 2c8m_C 2c8m_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]