SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ba0_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ba0_B
Domain Number 1 Region: 51-139
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.42e-22
Family Cold shock DNA-binding domain-like 0.0000208
Further Details:      
 
Domain Number 2 Region: 137-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000202
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000022
Family ECR1 N-terminal domain-like 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2ba0_B
Sequence length 229
Comment mol:protein length:229 Archaeal exosome RNA binding protein RRP4
Sequence
mrkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdv
vigiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkm
kvtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvn
gdrrkvsiaeeaiylieqeahtegltdrvaefikrrkadvgiqhhhhhh
Download sequence
Identical sequences 2ba0A 2ba0_A 2ba0_B 2ba0_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]