SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ctk_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ctk_A
Domain Number 1 Region: 17-88
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.42e-25
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2ctk_A
Sequence length 104
Comment mol:protein length:104 Vigilin
Sequence
gssgssgkealealvpvtievevpfdlhryvigqkgsgirkmmdefevnihvpapelqsd
iiaitglaanldrakagllervkelqaeqedralrsfksgpssg
Download sequence
Identical sequences 2ctkA 2ctk_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]