SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2dw5_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2dw5_A
Domain Number 1 Region: 302-671
Classification Level Classification E-value
Superfamily Pentein 2.82e-286
Family Peptidylarginine deiminase Pad4, catalytic C-terminal domain 0.0000000879
Further Details:      
 
Domain Number 2 Region: 121-301
Classification Level Classification E-value
Superfamily Peptidylarginine deiminase Pad4, middle domain 1.32e-101
Family Peptidylarginine deiminase Pad4, middle domain 0.000000436
Further Details:      
 
Domain Number 3 Region: 15-119
Classification Level Classification E-value
Superfamily Cupredoxins 4.16e-63
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.00000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2dw5_A
Sequence length 671
Comment mol:protein length:671 Protein-arginine deiminase type-4
Sequence
gplgspefmaqgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdi
ahsppakkkstgsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
vapwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdem
eigyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlev
sppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghv
deflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsn
ktlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvl
gkhlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhcgtnvrrk
pfsfkwwnmvp
Download sequence
Identical sequences 2dw5A 2dw5_A 3b1t_A 3b1u_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]