SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ez4_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ez4_A
Domain Number 1 Region: 368-588
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.51e-55
Family Pyruvate oxidase and decarboxylase PP module 0.00000000239
Further Details:      
 
Domain Number 2 Region: 2-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.8e-45
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000591
Further Details:      
 
Domain Number 3 Region: 194-365
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.66e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2ez4_A
Sequence length 603
Comment mol:protein length:603 Pyruvate oxidase
Sequence
mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwi
kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
ggf
Download sequence
Identical sequences 2ez4_A 2ez4_B 2ez8_A 2ez8_B 2ez9_A 2ez9_B 2ezt_A 2ezt_B 2ezu_A 2ezu_B 2ez9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]