SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fbq_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fbq_A
Domain Number 1 Region: 84-211
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.52e-39
Family Tetracyclin repressor-like, C-terminal domain 0.000000236
Further Details:      
 
Domain Number 2 Region: 10-61
Classification Level Classification E-value
Superfamily Homeodomain-like 1.48e-20
Family Tetracyclin repressor-like, N-terminal domain 0.00026
Further Details:      
 
Domain Number 3 Region: 7-66
Classification Level Classification E-value
Superfamily PDB 0.0000000000236
Family PDB 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2fbq_A
Sequence length 235
Comment mol:protein length:235 probable transcriptional regulator
Sequence
ghmaqsetverildaaeqlfaekgfaetslrlitskagvnlaavnyhfgskkaliqavfs
rflgpfcaslekeldrrqakpeaqhatledllhllvsqamavkprsgndlsifmrllgla
fsqsqghlrkyleevygkvfrrymllvneaapklppielfwrvhfmlgaaafsmsgikal
ramaetdfgvntsteqvmhlmvpffaagmraesgiddpllagaqlrprnktpaka
Download sequence
Identical sequences 2fbqA 2fbq_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]