SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fsv_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fsv_C
Domain Number 1 Region: 31-202
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.85e-146
Family Transhydrogenase domain III (dIII) 0.0000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2fsv_C
Sequence length 203
Comment mol:protein length:203 NAD(P) transhydrogenase subunit beta
Sequence
mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
tadvafvigandvtnpaaktdpsspiygmpildvwkagtvlfikrsmasgyagvenelff
rnntmmlfgdakkmteqivqamn
Download sequence
Identical sequences 2fsv_C 2fsvC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]