SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gfn_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gfn_A
Domain Number 1 Region: 82-195
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.26e-24
Family Tetracyclin repressor-like, C-terminal domain 0.00000115
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily Homeodomain-like 5.62e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2gfn_A
Sequence length 209
Comment mol:protein length:209 HTH-type transcriptional regulator pksA related protein
Sequence
vpkivdhderrraladavlaliaregisavttravaeesgwstgvlnhyfgsrhelllaa
lrragdiqgdryrtildeegagpieklrnitasilplderrlamtrvflffyaegaaeet
argeiaaflarwrgvvresvvaaqregtvstdldadavtvalvaltdglalqaildpvvm
kaisaedaaarcvdaavrrtteeagavgr
Download sequence
Identical sequences APC6003 2gfnA 2gfn_A 2gfn_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]