SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gzl_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gzl_A
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily IpsF-like 4.61e-116
Family IpsF-like 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2gzl_A
Sequence length 159
Comment mol:protein length:159 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Sequence
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallika
Download sequence
Identical sequences 2gzl_A cath|current|2gzlA00/-1-157 2gzlA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]