SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2i10_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2i10_B
Domain Number 1 Region: 81-192
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.35e-28
Family Tetracyclin repressor-like, C-terminal domain 0.000000786
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily Homeodomain-like 3.61e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2i10_B
Sequence length 202
Comment mol:protein length:202 Putative TetR transcriptional regulator
Sequence
ghmpggrrrgfddqvalqtamelfwrqgyegtsitdltkalginppslyaafgskrdlfe
ktldrymcertlqleeamvrptaheavldfltgrvevftapgqpfgcmtvqaglasgeph
heivdlltaareqmrqtvldrfekaladgdlpagtdctalaryvmaavyglsveaasgap
reeltaaailaaqvvpraqmgs
Download sequence
Identical sequences 2i10A 2i10_A 2i10_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]