SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ima_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ima_A
Domain Number 1 Region: 23-443
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-160
Family Clostridium neurotoxins, catalytic domain 0.0000000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2ima_A
Sequence length 444
Comment mol:protein length:444 Botulinum neurotoxin A light-chain
Sequence
mgsshhhhhhssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihn
kiwviperdtftnpeegdlnpppeakqvpvsyydstylstdnekdnylkgvtklferiys
tdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadi
iqfecksfghevlnltrngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavt
lahelihaghrlygiainpnrvfkvntnayyemsglevsfeelrtfgghdakfidslqen
efrlyyynkfkdiastlnkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdk
lykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaan
fngqnteinnmnftklknftglfe
Download sequence
Identical sequences 2ilp_A 2ilp_B 2ima_A 2ima_B 2imb_A 2imb_B 2imc_A 2imc_B 5v8p_A 5v8p_B 5v8r_A 5v8r_B 5v8u_A 5v8u_B 2ilpA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]