SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2o7o_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o7o_A
Domain Number 1 Region: 67-200
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.07e-40
Family Tetracyclin repressor-like, C-terminal domain 0.000067
Further Details:      
 
Domain Number 2 Region: 3-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000209
Family Tetracyclin repressor-like, N-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2o7o_A
Sequence length 207
Comment mol:protein length:207 Tetracycline repressor protein class D
Sequence
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
geqaflhgleslirgfevqltallqiv
Download sequence
Identical sequences 2vkeA 1bjz_A 1ork_A 2fj1_A 2o7o_A 2vke_A 2x6o_A 2x9d_A 2xpu_A 2xpv_A 2xpw_A 4abz_A 4v2f_A 4v2g_A 4v2g_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]