SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2p5i_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p5i_A
Domain Number 1 Region: 15-276
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.63e-68
Family LplA-like 0.000000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2p5i_A
Sequence length 288
Comment mol:protein length:288 BH3822 protein
Sequence
mslslllqqhlsqpwrfldhtsfgptfqalqsfayddtlctsigksqspptlrawvhhnt
vvlgiqdsrlpqikagiealkgfqhdvivrnsgglavvldsgilnlslvlkeekgfsidd
gyelmyelicsmfqdhreqieareivgsycpgsydlsidgkkfagisqrrirggvavqiy
lcvsgsgaerakmirtfydkavagqptkfvyprikpetmaslsellgqphnvsdvllkal
mtlqqhgasllteslsadewllyeqhfarisernekllaeeghhhhhh
Download sequence
Identical sequences 2p5i_A 2p5iA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]