SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2raq_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2raq_C
Domain Number 1 Region: 8-94
Classification Level Classification E-value
Superfamily MTH889-like 4.03e-46
Family MTH889-like 0.0000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2raq_C
Sequence length 97
Comment mol:protein length:97 Conserved protein MTH889
Sequence
MVAKGLIRIVLDILKPHEPIIPEYAKYLSELRGVEGVNITLMEIDKETENIKVTIQGNDL
DFDEITRAIESYGGSIHSVDEVVAGRTMVEEVTTPQD
Download sequence
Identical sequences A0A223ZEU9 O26975 T2GJA6
WP_010876522.1.101079 WP_010876522.1.22989 2raq_A 2raq_B 2raq_C 2raq_D 2raq_E 2raq_F 2raq_G 2raqA APC7568 TR9 TT205 gi|15678909|ref|NP_276026.1| 187420.MTH889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]