SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2xmu_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2xmu_A
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000000638
Family HMA, heavy metal-associated domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2xmu_A
Sequence length 64
Comment mol:protein length:64 SSR2857 PROTEIN
Sequence
MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAG
HEVE
Download sequence
Identical sequences L8AHW8 P73213
gi|16329832|ref|NP_440560.1| 1sb6A gi|383321574|ref|YP_005382427.1| 000005147|e1sb6A1|304.3.1.7|A:1-64 cath|current|1sb6A00/1-64 cath|current|2xmjA00/2-64 cath|current|2xmjB00/2-64 cath|current|2xmkA00/1002-1064 cath|current|2xmkB00/2002-2064 cath|current|2xmtA00/2-64 cath|current|2xmtB00/2-64 cath|current|2xmuA00/2-64 cath|current|2xmuB00/2-64 d1sb6a_ gi|383324743|ref|YP_005385596.1| CIRMMP34 gi|383490627|ref|YP_005408303.1| 1sb6_A 2xmj_A 2xmj_B 2xmk_A 2xmk_B 2xmt_A 2xmt_B 2xmu_A 2xmu_B WP_010871869.1.11876 WP_010871869.1.1889 WP_010871869.1.18904 WP_010871869.1.33690 WP_010871869.1.35395 WP_010871869.1.47586 WP_010871869.1.99424 gi|16329832|ref|NP_440560.1| 1148.ssr2857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]