SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2yvx_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2yvx_C
Domain Number 1 Region: 303-470
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 8.78e-50
Family MgtE membrane domain-like 0.0000000286
Further Details:      
 
Domain Number 2 Region: 157-288
Classification Level Classification E-value
Superfamily CBS-domain pair 4.59e-40
Family CBS-domain pair 0.00000139
Further Details:      
 
Domain Number 3 Region: 32-154
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 2.49e-26
Family MgtE N-terminal domain-like 0.000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2yvx_C
Sequence length 473
Comment mol:protein length:473 Mg2+ transporter MgtE
Sequence
mgsshhhhhhssglgvlpggplhmeeklavslqealqegdtralrevleeihpqdllalw
delkgehryvvltllpkakaaevlshlspeeqaeylktlppwrlreileelslddladal
qavrkedpayfqrlkdlldprtraevealaryeedeagglmtpeyvavregmtveevlrf
lrraapdaetiyyiyvvdekgrlkgvlslrdlivadprtrvaeimnpkvvyvrtdtdqee
varlmadydftvlpvvdeegrlvgivtvddvldvleaeatedihklgavdvpdlvyseag
pvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpvllgtggntgnqsatl
iiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdghplllpvvgvslvli
vffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsvarllleav
Download sequence
Identical sequences 2yvxA 2yvx_A 2yvx_B 2yvx_C 2yvx_D 2zy9_A 2zy9_B 5x9h_A 5x9h_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]