SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3be7_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3be7_A
Domain Number 1 Region: 59-361
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.05e-112
Family Zn-dependent arginine carboxypeptidase-like 0.000000000488
Further Details:      
 
Domain Number 2 Region: 7-56
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 6.47e-17
Family Zn-dependent arginine carboxypeptidase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3be7_A
Sequence length 408
Comment mol:protein length:408 Zn-dependent arginine carboxypeptidase
Sequence
msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
Download sequence
Identical sequences 3be7_A 3be7_B 3be7_C 3be7_D 3be7_E 3be7_F 3be7_G 3be7_H 3dug_A 3dug_B 3dug_C 3dug_D 3dug_E 3dug_F 3dug_G 3dug_H 3be7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]