SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3bti_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bti_A
Domain Number 1 Region: 73-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.15e-38
Family Tetracyclin repressor-like, C-terminal domain 0.000000678
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000101
Family Tetracyclin repressor-like, N-terminal domain 0.0000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3bti_A
Sequence length 188
Comment mol:protein length:188 HTH-type transcriptional regulator qacR
Sequence
mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
iflnglsk
Download sequence
Identical sequences 3btiA 3bti_A 3bti_B 3bti_D 3bti_E 3btj_A 3btj_B 3btj_D 3btj_E 3btl_A 3btl_B 3btl_D 3btl_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]